PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold20437-augustus-gene-0.2-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB
Protein Properties Length: 226aa    MW: 25715.5 Da    PI: 6.8068
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold20437-augustus-gene-0.2-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.41.4e-07346445
                                                  S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
                               Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                                                  W   Ed+ + +a  + + +   +W +Ia+ ++ g+++ ++k+++ 
  maker-scaffold20437-augustus-gene-0.2-mRNA-1  3 WNRSEDKVFEQALVMVPEDvpdRWQRIAEQIP-GKSPRDVKEHYD 46
                                                  9999****************************.**********95 PP

2Myb_DNA-binding48.42.2e-15109153347
                                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                                   +WT+eE+ l++ + k++G+g+W++I+r +  +Rt+ q+ s+ qky
  maker-scaffold20437-augustus-gene-0.2-mRNA-1 109 PWTEEEHRLFLTGLKKFGKGDWRSISRNVVVTRTPTQVASHAQKY 153
                                                   8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.592155IPR017884SANT domain
SuperFamilySSF466892.3E-10357IPR009057Homeodomain-like
CDDcd001671.81E-6345No hitNo description
Gene3DG3DSA:1.10.10.606.5E-5346IPR009057Homeodomain-like
SMARTSM007170.001351IPR001005SANT/Myb domain
PfamPF002492.8E-6346IPR001005SANT/Myb domain
PROSITE profilePS5129420.567102158IPR017930Myb domain
SuperFamilySSF466893.16E-17104159IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-18105157IPR006447Myb domain, plants
SMARTSM007175.0E-13106156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-12106152IPR009057Homeodomain-like
CDDcd001672.89E-11109154No hitNo description
PfamPF002493.7E-13109153IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MMWNRSEDKV FEQALVMVPE DVPDRWQRIA EQIPGKSPRD VKEHYDDLVH DVLEIDSGRV  60
ELPSYADDDD SDSGGHGGWD SPSNQNQISF SNHNNKPKHS DSERKKGTPW TEEEHRLFLT  120
GLKKFGKGDW RSISRNVVVT RTPTQVASHA QKYFLRQNSV KKERKRSSIH DITADNNPVA  180
LPVNQSWLPP PGSAVQQQQA YQTITMPPHL PGQVSSMGYQ NFGFPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-153651173RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006445756.11e-101hypothetical protein CICLE_v10016071mg
RefseqXP_013470249.11e-101MYB-like transcription factor family protein
TrEMBLG7ZYT01e-101G7ZYT0_MEDTR; DnaJ homolog subfamily C member
TrEMBLV4U9T91e-101V4U9T9_9R
STRINGGLYMA20G24600.13e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.18e-81MYB family protein